PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA61G00057
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 365aa    MW: 40291.1 Da    PI: 6.1108
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA61G00057genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.29.5e-193782147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W+teEd  l ++v+++G+++W++Iar ++ gR++k+c++rw + 
       AA61G00057 37 KGPWSTEEDAVLTKLVTKFGPRNWSLIARGIP-GRSGKSCRLRWCNQ 82
                     79******************************.***********985 PP

2Myb_DNA-binding51.42.5e-1689133147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r++++ eEd  ++ a++ +G++ W+ Ia+ ++ gRt++ +k++w++ 
       AA61G00057  89 RKPFSDEEDSMIISAHAVHGNK-WAVIAKLLP-GRTDNAIKNHWNST 133
                      789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.6983287IPR017930Myb domain
SuperFamilySSF466891.12E-3034130IPR009057Homeodomain-like
SMARTSM007177.8E-153685IPR001005SANT/Myb domain
PfamPF002492.2E-163782IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-253890IPR009057Homeodomain-like
CDDcd001673.90E-143981No hitNo description
SMARTSM007174.8E-1688136IPR001005SANT/Myb domain
PROSITE profilePS5129421.26988138IPR017930Myb domain
PfamPF002491.5E-1489133IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-2491137IPR009057Homeodomain-like
CDDcd001674.43E-1291134No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MERETHQSAE SDEGISAAID AELVELTAGG GIRSKVKGPW STEEDAVLTK LVTKFGPRNW  60
SLIARGIPGR SGKSCRLRWC NQLDPCLKRK PFSDEEDSMI ISAHAVHGNK WAVIAKLLPG  120
RTDNAIKNHW NSTLKRKYSD LFKNGTWIGN NNSVTPYIKN ENVETTPNST SKEEINASKP  180
PHQSDIAMDE ATTKPQDQTP TETNVIRPVA RLSAFSVYNP SSQRIGYRDQ HIVPCEGPLI  240
QAAKPDSLAG KFLQSLCDEP QIPSKCGHGC CSSPTQTVPS SHNSILGPDF VDYEEPCAVF  300
NQELISIATD LNNIAWIRSG LDNNLVRDEE QSLKVDNGNF NGERVNFNGM IPTQIPRQDF  360
FCASN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-40311371107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_191132.10.0myb domain protein 109
TrEMBLQ9LDW50.0Q9LDW5_ARATH; MYB transcription factor-like protein
STRINGAT3G55730.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56382747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.10.0myb domain protein 109